
Welcome to Norway Days at EXPO 2025 in Japan!
1 June 2025 - 3 June 2025
Exhibition
Norway Day at EXPO 2025 in Osaka is bringing together key government and business representatives from Japan and Norway, to celebrate the long-term partnership in a range of areas. This also coincides with celebrations of 120 years of diplomatic relations. Under the theme “Pioneering a sustainable future – together”, events will feature seminars and networking sessions both at the Nordic pavilion at EXPO in Osaka as well as in Tokyo. Business dialogue will cover seafood supply, renewable energy developments, securing critical infrastructure at sea as well as diversity and equality in society and business. The delegation is lead by Espen Barth Eide, Norwegian Minister of Foreign Affairs travelling together with Ragnhild Sjoner Syrstad, State Secretary, Ministry of Trade, Industry and Fisheries.
Programme elements
For full programme, please see programme tab or attachments below.
Norway Day in Osaka will take place at the EXPO area. The official ceremony will mark the opening of Norway day, with flag-raising og Norway and Japan and greetings by high-level representatives of both countries, while the business dialogue event and reception will be at the Nordic pavilion. Sessions at the pavilion will be consecutive in the same venue and with simultaneous interpretation.
Transportation from Osaka to Tokyo:
Train Osaka-Tokyo, Shinkansen, approx. 2hrs 30 min
Norway Day in Tokyo will take place at Hotel Gajoen in Meguro, a central part of the city. Sessions will be taking place in parallel, all with simultaneous interpretation. All sessions will gather for a joint seafood reception.
Practical information
The following hotels are recommended in Tokyo, near the event venue Hotel Gajoen:
- Shinagawa Prince Hotel Right across the street from Shinagawa Station, with direct access to the Shinkansen and Haneda Airport
- JR-EAST HOTEL METS PREMIER GOTANDA Located at Gotanda station, which is between Shinagawa and Meguro station.
- Hotel Metropolitan Tokyo directly connected to Tokyo Station.
Practical information will follow later.
Ann Elin Hattrem
Special Advisor
Oslo
Organised by Team Norway

All times are in GMT+09:00
Get together in Osaka at Canopy by Hilton
Canopy by Hilton · 18:00 - 20:00
Canopy by Hilton
18:00 - 20:00
All times are in GMT+09:00
EXPO Osaka: Official opening, cultural event, pavilion visits, business dialogue and panels
Expo 2025 Osaka Yumeshima Island · 10:30 - 18:30
Expo 2025 Osaka Yumeshima Island
10:30 - 18:30
PART 1
11:00-11:20 Official Ceremony
- Flag-raising of Norway and Japan.
- Greetings by representatives of Norway, Japan, and the event organizers.
- 11:20-12:00 Official Special Event: Cultural Programme
- Performance showcasing Norwegian musician Helene Bøksle
- 12:00-13:00 Lunch Break
- Networking lunch, served at the Nordic pavilion restaurant
- 13:00-15:15 EXPO pavilion visits
- Organized tour to selected pavilions
PART 2
15:30-18:30 Japan-Norway business dialogue at Nordic Pavilion
MC: Finn Kristian Aamodt, Commissionaire General for Norway at the Nordic Pavilion
15:30-15:55 OPENING
- Welcome remarks: Kristin Iglum, Ambassador of Norway to Japan
- Keynote 1: “Security in a new geopolitical situation – importance of cooperation”
- Espen Barth Eide, Minister of Foreign Affairs
- Keynote 2: “The importance of Norway-Japan partnership in a new world trade order”
- Haakon Haugli, CEO, Innovation Norway
15:55-16:30 Panel 1: “Securing critical infrastructure”
Moderator: Svein Grandum, Counsellor, Head of Trade and Technology Office, Norwegian Embassy, Trade and Technology Office
Panelists:
- Espen Barth Eide, Minister of Foreign Affairs
- Anders Rønningen, Executive Vice President, Kongsberg Discovery
- Ditlev Engel, Chief Executive Officer, Energy Systems DNV
- Hide Sakaguchi, Executive Advisor, Sasakawa Peace Foundation
16:30-17:05 Panel 2: “Developing cost efficient energy value chains”
Moderator: Per Christer Lund, Counsellor Energy and Technology, Norwegian Embassy, Trade and Technology Office
Panelists:
- Ragnhild Sjorner Syrstad, State Secretary, Ministry of Trade, Industry and Fisheries
- Ingunn Svegården, Senior Vice President Asia Pacific Renewables & Country Manager Singapore, Equinor
- David Povall, Senior Executive Officer, Offshore Wind, Renewable Energy Division, Kansai Electric Power Company
17:05-17:20 Break
17:20-17:55 Panel 3: “Securing food supply chains”
Moderator: Idar Kreutzer, International Director, Confederation of Norwegian Enterprise (NHO)
Panelists:
- Mr. Rolf Kristian Vaage, CSO, Pelagia
- Ms. Elisabeth Haugen, Sales Manager Japan & SE Asia, Ocean Supreme
- Mr. Yasuda Satoshi, Managing Director, Thyms & Co. Ltd.
- Mr. Kaneko Naoki, President, Ocean Trading Co. Ltd.
17:55-18:30 Panel 4: “Diversity and equality in productive global business”
Moderator: Akiko Shiono, Community Director, Nordic Innovation House Tokyo
Panelists:
- Idar Kreutzer, International Director, Confederation of Norwegian Enterprise (NHO)
- Cathrine Thomassen, CEO GE Healthcare Norway
FFinn Kristian Aamodt , Moderator
LinkedIn
KIKristin Iglum, Norwegian Ambassador to Japan
LinkedIn
Espen Barth Eide, Minister of Foreign Affairs
HHHåkon Haugli, CEO, Innovation Norway
LinkedIn
IKIdar Kreutzer, International Director, Confederation of Norwegian Enterprise (NHO)
RVRolf Kristian Vaage, CSO, Pelagia
LinkedIn
EHElisabeth Haugen, Sales Manager, Japan & SE Asia, Ocean Supreme
LinkedIn
YSYasuda Satoshi, Managing Director, Thyms & Co. Ltd.
KNKaneko Naoki, President, Ocean Trading Co. Ltd.
RSRagnhild Sjoner Syrstad, State Secretary, Ministry of Trade, Industry and Fisheries
LinkedIn
ISIngunn Svegården, Senior Vice President Asia Pacific Renewables & Country Manager Singapore, Equinor
LinkedIn
DPDavid Povall, Senior Executive Officer, Offshore Wind, Renewable Energy Division, Kansai Electric Power Company
LinkedIn
ARAnders Rønningen, Executive Vice President, Kongsberg Discovery
LinkedIn
DEDitlev Engel, Chief Executive Officer, Energy Systems DNV
LinkedIn
HSHide Sakaguchi, Executive Advisor, Sasakawa Peace Foundation
CTCathrine Thomassen, CEO GE Healthcare Norway
LinkedIn
CTHSDEARDPISRSKNYSEHRVIKHHKIFEXPO Osaka: Networking Reception at the Nordic Pavilion
Expo 2025 Osaka Yumeshima Island · 18:30 - 20:30
Expo 2025 Osaka Yumeshima Island
18:30 - 20:30
All times are in GMT+09:00
Tokyo Session 2: Renewable Energy - "Advancing Global Energy Solutions through Offshore Wind and Low-Carbon Value Chains
Hotel Gajoen Tokyo · 13:00 - 18:00
Hotel Gajoen Tokyo
13:00 - 18:00
MC: Marianne Støren Berg, Norwegian Embassy, Trade and Technology Office
13:00-14:15 OPENING
Overview: Reflection on the global energy situation under the current geopolitical situation with relevance and importance of energy partnership between Japan and Norway, aligning with energy security and joint technology developments.
Signing ceremonies:
Memorandum of Understanding between FLOWRA and DNV for cooperation within floating offshore wind.
Memorandum of Understanding between FLOWRA and Innovation Norway for advancing Japan-Norway offshore wind partnership.
Opening Address 1: Ragnhild Sjoner Syrstad, State Secretary, Norwegian Ministry of Trade, Industry and Fisheries
Opening Address 2: Noriyoshi Fukuoka, Director Wind Energy Policy, Japanese Agency for Natural Resources and Energy, Ministry of Economy, Trade and Industry (METI)
Keynote speaker: Nobuo Tanaka, Executive Director Emeritus, International Energy Agency (IEA), Chair of the Steering Committee of Innovation for Cool Earth Forum (ICEF)
14:15 - 15:15 Global energy markets in transition
Both Japan and Norway are navigating the transition in volatile global energy markets. We are complimentary where Japan, heavily reliant on imported fossil fuels, is accelerating its efforts to diversify its energy mix and Norway positioning itself as a global supplier of low carbon energy based on green electrons and blue molecules.Our complementarily meets in developing and deploying frontier energy areas such as offshore wind and ammonia value chain.This session will address the global challenges and importance of cooperation between same-minded and less political volatile nations to reach common goals.
Panel discussion:
Theme: Strategies for collaboration amidst in a volatile geopolitical world – the trilemma of energy security, affordability and sustainability.
Moderator: Per Christer Lund, Counsellor Energy and Technology, Norwegian Embassy, Trade and Technology Office
Introduction: Lars Erik Nicolaisen, Deputy Chief Executive Officer, Rystad Energy, “The Energy Trilemma – shifting priorities”
Panelists:
- Ingunn Svegården, Senior Vice President Asia Pacific Renewables & Country Manager Singapore, Equinor:
- Lars Eirik Nicolaisen,Deputy Chief Executive Officer, Rystad Energy
- Marta Marmiroli, General Manager of Power Grid Engineering, Mitsubishi Electric Corporation
- Andreas Alnes, Senior Vice President and Head of Group procurement, Statkraft
15:15-15:45 Coffee break
15:45-16:45 Accelerating offshore wind collaboration
Japan has recently opened its huge Exclusive Economic Zone (EEZ) for harvesting one of the world's most promising offshore wind energy sources, most of this from floating offshore wind. Whereas Japan has very little experience from domestic offshore industry, Norway can complement with 50 years of offshore oil and gas and 15 years of floating offshore wind projects. This session will address current and growing collaboration on regulatory, technological, efficiency and economic aspects of floating wind development.
Panel discussion:
Theme: Long-term partnership, joint technology development, cost reduction and international standardization
Moderator: Per Christer Lund, Counsellor Energy and Technology, Norwegian Embassy, Trade and Technology Office
Introduction: Håkon Haugli, Chief Executive Officer, Innovation Norway, “Norwegian incentive and funding schemes to promote deployment of floating offshore wind”
Panelists:
- Sille Grjotheim, Global Segment Director Offshore Wind, DNV
- Mototsugu Ikari, General Manager International Relations, Floating Offshore Wind Technology Research Association (FLOWRA).
- Tone Lunde Bakker, Chief Executive Officer, Export Finance Norway
- Håkon Haugli, Chief Executive Officer, Innovation Norway
16:45-17:15 Coffee break
17:15-18:15 Low-carbon energy value chains
Whereas Japan has been the driver over the last 20 years for global hydrogen and ammonia value chains to lower its carbon footprint, Norway is exploiting its production and export capacity for green and blue low carbon energy. Although a direct supply chain from Norway and Japan seems unlikely right now, this seminar will address collaboration of supporting technologies, including production, transport and storage and downstream utilization of these low carbon molecules.
Panel discussion:
Challenges and solutions for implementing carbon capture and hydrogen/ammonia projects. Regulatory and technological hurdles
Moderator: Per Christer Lund, Counsellor Energy and Technology, Norwegian Embassy, Trade and Technology Office
Introduction: Hiroshi Nambo, General Manager, Global CCS Institute (Japan): Japan’s position on CCS and low-carbon value chains
Panelists:
- Hiroshi Nambo, General Manager, Global CCS Institute (Japan)
- James Laybourn, Regional Sales Director, Energy Systems, DNV
- Shigeru Muraki, President, Clean Fuel Ammonia Association
- Satoshi Kanamori, Senior Managing Corporate Officer,Responsible for Technical Unit, Supervising Liquified Gas Business, in charge of LNG. "K" Line (Kawasaki Kisen Kaisha, Ltd).
18:15-18:20 Closing
18:30-20:30 Networking Seafood Reception (jointly Session 1, 2 and 3)
MBMarianne Støren Berg, Counsellor Science, Technology and Higher Educaction
RSRagnhild Sjoner Syrstad, State Secretary, Ministry of Trade, Industry and Fisheries
LinkedIn
NFNoriyoshi Fukuoka, Director Wind Energy Policy, Japanese Agency for Natural Resources and Energy, Ministry of Economy, Trade and Industry (METI)
LinkedIn
NTNobuo Tanaka, Executive Director Emeritus, International Energy Agency (IEA), Chair of the Steering Committee of Innovation for Cool Earth Forum (ICEF)
PLPer Christer Lund, Special Advisor – Clean Energy
LinkedIn
LNLars Eirik Nicolaysen, Deputy CEO - Rystad Energy
LinkedIn
ISIngunn Svegården, Senior Vice President Asia Pacific Renewables & Country Manager Singapore, Equinor
LinkedIn
MMMarta Marmiroli, General Manager of Power Grid Engineering, Mitsubishi Electric Corporation
LinkedIn
AAAndreas Alnes, Senior Vice President and Head of Group procurement, Statkraft
HHHåkon Haugli, CEO, Innovation Norway
LinkedIn
SGSille Grjotheim, Global Segment Director Offshore Wind, DNV
LinkedIn
MIMototsugu Ikari, General Manager International Relations, Floating Offshore Wind Technology Research Association (FLOWRA)
LinkedIn
TBTone Lunde Bakker, CEO, Export Finance Norway
LinkedIn
HNHiroshi Nambo, General Manager, Global CCS Institute (Japan)
LinkedIn
JJames Laybourn , Regional Sales Director, Energy Systems, DNV
SMShigeru Muraki, President, Clean Fuel Ammonia Association
SKSatoshi Kanamori, Managing Executive Officer, LNG, Carbon Solution Business, "K" Line (Kawasaki Kisen Kaisha, Ltd)
LinkedIn
SKSMJHNTBMISGHHAAMMISLNPLNTNFRSMBTokyo Session 3: From Deep Ocean to Space - "Securing critical infrastructure"
Hotel Gajoen Tokyo · 13:00 - 18:00
Hotel Gajoen Tokyo
13:00 - 18:00
Norway and Japan have a long-standing history of international maritime and space cooperation in research, technology, and business development. This session will raise awareness among both the Norwegian and Japanese authorities and stakeholders about our cooperation, common interests, and future opportunities for joint activities from deep ocean to deep space. With the recent geopolitical situation, it is highly important to develop close relationship with like-minded countries, like Norway and Japan, to enhance security and resilience of critical infrastructure.
MC: Finn Kristian Aamodt, Norway's Commissioner General for Expo 2025 Osaka
13:00-13:30 Opening
Welcome: Kristin Iglum, Ambassador of Norway to Japan
Address 1: Espen Barth Eide, Minister of Foreign Affairs
Address 2: Jun Kazeki, Director-General of the National Space Policy Secretariat, Cabinet Office
13:30-15:00 “Protection of Critical Infrastructure - maritime domain awareness”
Moderator: Maja Stina Ekstedt, Executive Vice President of Sustainability & Public Relations, Kongsberg Satellite Services (KSAT)
There are severe changes and unpredictability in the world today, both due to geopolitics and climate changes.
This creates demands for new understanding, new analysis and new solutions.
This session focuses on the protection of critical infrastructure,such as ports, ships, communication solutions, energy and monitoring infrastructure, etc., and enhancement of maritime surveillance services and the integration of various sensors and data sources to detect and monitor maritime activities.
We hope to highlight the commonalities between Japan and Norway in this domain and the opportunities for collaboration and working together in order to address today's security challenges.
Keynote speakers:
- Geir Håøy, CEO, Kongsberg Group
- Ditlev Engel, CEO Energy Systems, DNV
- Hide Sakaguchi, Executive Advisor, Sasakawa Peace Foundation
Panel discussion:
Panelists:
- Geir Håøy, CEO, Kongsberg Group
- Ditlev Engel, CEO Energy Systems, DNV
- Hide Sakaguchi, Executive Advisor, Sasakawa Peace Foundation
- Tomonori Ueno, General Manager, Aerospace Defense & Technology Strategic Business Unit, Sumitomo Corporation, and President & CEO, Sumisho Aero-Systems Corporation
- Anders Rønningen, EVP Seatex, Kongsberg Discovery
15:00-15:40 Coffee break
15:40-17:50 “Space technology as a tool for situational awareness”
15:40-15:50 Signing Ceremony
Moderator:Kenneth Olafsson, Representative Director of KSAT Japan G.K., Head of KSAT Asia, Kongsberg Satellite Services (KSAT)
This session will be presenting the importance and the role of space technology as a tool for maritime surveillance and the development of innovative solutions being implemented to improve and support maritime and multi-domain awareness.
Keynote speakers:
Rolf Skatteboe, President & CEO, Kongsberg Satellite Services (KSAT)
- Kenji Minami, Deputy Director-General, Department of Project Management, ATLA, Ministry of Defense, Japan
- Riko Oki, Counselor, Associate Senior Chief Officer of Earth Observation Mission, Space Technology Directorate I, JAXA
- Mitsuru Ishii, Executive Director, SKY Perfect JSAT Corporation
Arne Gjennestad, Vice President Business Development Defence Space & Surveillance, Kongsberg Defence & Aerospace (KDA)
Panel discussion:
Panelists:
- Kenji Minami, Deputy Director-General, Department of Project Management,
ATLA, Ministry of Defense, Japan
- Rolf Skatteboe, CEO, President & CEO, Kongsberg Satellite Services (KSAT)
- Takayoshi Fukuyo, Founder & CEO, ArkEdge Space Inc.
- Takashi Ogai, Manager, Project Group, Space Systems Business Development Office, Aero Engine, Space & Defense Business Area, IHI Corporation
- Arne Gjennestad, Vice President Business Development Defence Space & Surveillance, Kongsberg Defence & Aerospace (KDA)
17:50-18:00 Concluding remarks by Finn Kristian Aamodt
18:30-20:30 Networking Seafood Reception (jointly Session 1, 2 and 3)
FFinn Kristian Aamodt , Commissionaire General for Norway at the Nordic Pavilion
LinkedIn
KIKristin Iglum, Norwegian Ambassador to Japan
LinkedIn
Espen Barth Eide, Minister of Foreign Affairs
JKJun Kazeki, Director-General of the National Space Policy Secretariat, Cabinet Office
MEMaja Stina Ekstedt, Executive Vice President of Sustainability & Public Relations
LinkedIn
GHGeir Håøy, CEO, Kongsberg Group
LinkedIn
DEDitlev Engel, Chief Executive Officer, Energy Systems DNV
LinkedIn
HSHide Sakaguchi, Executive Advisor, Sasakawa Peace Foundation
ARAnders Rønningen, Executive Vice President, Kongsberg Discovery
LinkedIn
TUTomonori Ueno, General Manager, Aerospace Defense & Technology Strategic Business Unit, Sumitomo Corporation
LinkedIn
RSRolf Skatteboe, CEO, Kongsberg Satellite Services (KSAT)
LinkedIn
KMKenji Minami, Deputy Director-General, Department of Project Management, Ministry of Defense, Japan, ATLA
RORiko Oki, Counselor, Associate Senior Chief Officer of Earth Observation Mission, Space Technology Directorate I, JAXA
MIMitsuri Ishii, Executive Director, SKY Perfect JSAT Corporation
TFTakayoshi Fukuyo, CEO, ArkEdge Space
LinkedIn
TOTakashi Ogai, Manager, Project Group, Space Systems Business Development Office, Aero Engine, Space & Defense Business Area, IHI Corporation
AGArne Gjennestad, Vice President Business Development Defence Space & Surveillance, Kongsberg Defence & Aerospace (KDA)
LinkedIn
AGTOTFMIROKMRSTUARHSDEGHMEJKKIFNetworking Seafood Reception
Hotel Gajoen Tokyo · 18:30 - 20:30
Hotel Gajoen Tokyo
18:30 - 20:30